Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS18C Peptide - N-terminal region

MRPS18C Peptide - N-terminal region

Product Specifications

Product Name Alternative

MRP-S18-1, MRPS18-1

UniProt

Q9Y3D5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS18C Rabbit Polyclonal Antibody (orb587545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057151

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYKNVQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRP78 (HSPA5) Rabbit Polyclonal Antibody
AP06149PU-N 100 µg

GRP78 (HSPA5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTCHD3 (NM_001034842) Human Over-expression Lysate
LC421967 20 µg

PTCHD3 (NM_001034842) Human Over-expression Lysate

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/1398), CF640R conjugate, 0.1mg/mL
BNC401398-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/1398), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p-Tolyl Sulfate-d7 Potassium Salt
TRC-T536802-2.5MG 2.5 mg

p-Tolyl Sulfate-d7 Potassium Salt

Sign In for Pricing
View Details
Recombinant SLC29A1 Antibody
RC-6617-01 50 μL

Recombinant SLC29A1 Antibody

Sign In for Pricing
View Details
Recombinant SLC29A1 Antibody
RC-6617-02 100 µL

Recombinant SLC29A1 Antibody

Sign In for Pricing
View Details