Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6C6 Peptide - C-terminal region

OR6C6 Peptide - C-terminal region

Product Specifications

UniProt

A6NF89

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6C6 Rabbit Polyclonal Antibody (orb587625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005493

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VILSYTCIIKTILKFSSAQQRNKAFSTCTSHMIVVSMTYGSCIFMYIKPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB8B Protein Vector (Human) (pPM-C-His)
PV034072 500 ng

RAB8B Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
FOSL2 polyclonal antibody
orb641573-01 50 μL

FOSL2 polyclonal antibody

Sign In for Pricing
View Details
FOSL2 polyclonal antibody
orb641573-02 100 µL

FOSL2 polyclonal antibody

Sign In for Pricing
View Details
FOSL2 polyclonal antibody
orb641573-03 200 µL

FOSL2 polyclonal antibody

Sign In for Pricing
View Details
FMO3 Recombinant Antibody, FITC Conjugated
bsm-62346R-FITC-TR 20 µL

FMO3 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Calsequestrin 1 Conjugated Antibody
orb1611255 100 µL

Calsequestrin 1 Conjugated Antibody

Sign In for Pricing
View Details