Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6C6 Peptide - C-terminal region

OR6C6 Peptide - C-terminal region

Product Specifications

UniProt

A6NF89

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6C6 Rabbit Polyclonal Antibody (orb587625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005493

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VILSYTCIIKTILKFSSAQQRNKAFSTCTSHMIVVSMTYGSCIFMYIKPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein WWC3 (WWC3) Antibody (Biotin)
abx349552-01 50 µL

Protein WWC3 (WWC3) Antibody (Biotin)

Sign In for Pricing
View Details
Protein WWC3 (WWC3) Antibody (Biotin)
abx349552-02 100 µL

Protein WWC3 (WWC3) Antibody (Biotin)

Sign In for Pricing
View Details
Protein WWC3 (WWC3) Antibody (Biotin)
abx349552-03 200 µL

Protein WWC3 (WWC3) Antibody (Biotin)

Sign In for Pricing
View Details
Protein WWC3 (WWC3) Antibody (Biotin)
abx349552-04 1 mL

Protein WWC3 (WWC3) Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Human Ring Finger Protein 7
32-4668-20 20 µg

Recombinant Human Ring Finger Protein 7

Sign In for Pricing
View Details
Anti-Mouse CD4 FITC
MBS696661-01 0.025 mg

Anti-Mouse CD4 FITC

Sign In for Pricing
View Details