Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6K2 Peptide - C-terminal region

OR6K2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1-17

UniProt

Q8NGY2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6K2 Rabbit Polyclonal Antibody (orb587626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005279

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIALAFAVLSPFFNPIIYSLRNKEIKEAIKKHIGQAKIFFSVRPGTSSKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hnRNP F (HNRNPF) (NM_001098208) Human Over-expression Lysate
LY420556 100 µg

hnRNP F (HNRNPF) (NM_001098208) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethoxy-5-fluoro-4(3H)-pyrimidinone
TRC-E892040-10G 10 g

Ethoxy-5-fluoro-4(3H)-pyrimidinone

Sign In for Pricing
View Details
PHC1 Human Gene Knockout Kit (CRISPR)
KN422530 1 Kit

PHC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MSRB3 activation kit by CRISPRa
GA116758 1 Kit

Human MSRB3 activation kit by CRISPRa

Sign In for Pricing
View Details
CD226 Polyclonal Antibody
E-AB-12777-01 20 µL

CD226 Polyclonal Antibody

Sign In for Pricing
View Details
CD226 Polyclonal Antibody
E-AB-12777-02 60 µL

CD226 Polyclonal Antibody

Sign In for Pricing
View Details