OR6K2 Peptide - C-terminal region
OR6K2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR1-17
UniProt
Q8NGY2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR6K2 Rabbit Polyclonal Antibody (orb587626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005279
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AIALAFAVLSPFFNPIIYSLRNKEIKEAIKKHIGQAKIFFSVRPGTSSKI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682180-100 1x 100 µL
EGFR (Epidermal Growth Factor Receptor) (F4), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![FBXW7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C11]](https://cdn.genprice.uk/products/937/68dd1b79061270361ea1b581/imageurl/ta802883bm.webp)
TA802883BM 100 µL
FBXW7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C11]
Sign In for Pricing
View Details 
AP50816PU-N 400 µL
Cyclin H (CCNH) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details