Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6M1 Peptide - C-terminal region

OR6M1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-271

UniProt

Q8NGM8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6M1 Rabbit Polyclonal Antibody (orb587628) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005325

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KINFLLSALVILSSLAFTTGSYVYIISTILRIPSTQGRQKAFSTCASHIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2CD4A Human Gene Knockout Kit (CRISPR)
KN421228 1 Kit

C2CD4A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ucp1 Rabbit Monoclonal Antibody
TA423369 100 µL

Ucp1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS704454 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Apolipoprotein H (APOH) (NM_000042) Human Recombinant Protein
TP720364M 50 µg

Apolipoprotein H (APOH) (NM_000042) Human Recombinant Protein

Sign In for Pricing
View Details
Human IL3RA/CD123 Recombinant Rabbit monoclonal Antibody
HA723352 100 µL

Human IL3RA/CD123 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
3,4-Xylyl-6-phenylazo-D-ribitylamine
TRC-X750500-100MG 100 mg

3,4-Xylyl-6-phenylazo-D-ribitylamine

Sign In for Pricing
View Details