Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6M1 Peptide - C-terminal region

OR6M1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-271

UniProt

Q8NGM8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6M1 Rabbit Polyclonal Antibody (orb587628) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005325

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KINFLLSALVILSSLAFTTGSYVYIISTILRIPSTQGRQKAFSTCASHIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ULK1 Rabbit Polyclonal Antibody
TA392694 100 µL

ULK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COL19A1 Human Gene Knockout Kit (CRISPR)
KN416011 1 Kit

COL19A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Carnosic Acid
TRC-C184180-5MG 5 mg

Carnosic Acid

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3E Mouse Monoclonal Antibody [Clone ID: AT3H3]
AM50355PU-S 50 µL

CD3E Mouse Monoclonal Antibody [Clone ID: AT3H3]

Sign In for Pricing
View Details
Stigmasteryl Ferulate
TRC-S686768-2.5MG 2.5 mg

Stigmasteryl Ferulate

Sign In for Pricing
View Details