OR6M1 Peptide - C-terminal region
OR6M1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-271
UniProt
Q8NGM8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR6M1 Rabbit Polyclonal Antibody (orb587628) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005325
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KINFLLSALVILSSLAFTTGSYVYIISTILRIPSTQGRQKAFSTCASHIT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941712-500 1x 500 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC434175 20 µg
Aminoacylase 1 (ACY1) (NM_001198897) Human Over-expression Lysate
Sign In for Pricing
View Details 
ICH5005-10mg 10 mg (2x 5 mg)
Durvalumab Biosimilar - Research Grade
Sign In for Pricing
View Details