Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR7G1 Peptide - C-terminal region

OR7G1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR19-15, OR19-8, OR7G1P

UniProt

Q8NGA0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR7G1 Rabbit Polyclonal Antibody (orb587633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005192

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFGVYISSAVAESSRITAVASVMYTVVPQMMNPFIYSLRNKEMKKALRKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Rat CD44H Antibody
RD22292F-01 25 µg

FITC Anti-Rat CD44H Antibody

Sign In for Pricing
View Details
FITC Anti-Rat CD44H Antibody
RD22292F-02 100 µg

FITC Anti-Rat CD44H Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast, right
CS650594 5x 5 µm

Frozen Tissue Sections, Breast, right

Sign In for Pricing
View Details
SERPINB3 Human Gene Knockout Kit (CRISPR)
KN402683 1 Kit

SERPINB3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Drometrizole Trisiloxane
TRC-D679410-200MG 200 mg

Drometrizole Trisiloxane

Sign In for Pricing
View Details
Human MAPK6 activation kit by CRISPRa
GA103787 1 Kit

Human MAPK6 activation kit by CRISPRa

Sign In for Pricing
View Details