OR7G1 Peptide - C-terminal region
OR7G1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR19-15, OR19-8, OR7G1P
UniProt
Q8NGA0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR7G1 Rabbit Polyclonal Antibody (orb587633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005192
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AFGVYISSAVAESSRITAVASVMYTVVPQMMNPFIYSLRNKEMKKALRKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Elab Fluor® 594 Anti-Human/Mouse Integrin β7 Antibody[FIB21]](https://cdn.genprice.uk/products/763/68dd14a6061270361e7d1a95/imageurl08/an00423p.webp)
AN00423P-01 20 Tests
PE/Elab Fluor® 594 Anti-Human/Mouse Integrin β7 Antibody[FIB21]
Sign In for Pricing
View Details AN00423P-02 100 Tests
PE/Elab Fluor® 594 Anti-Human/Mouse Integrin β7 Antibody[FIB21]
Sign In for Pricing
View Details AN00423P-03 2x 100 Tests
PE/Elab Fluor® 594 Anti-Human/Mouse Integrin β7 Antibody[FIB21]
Sign In for Pricing
View Details 
BNC470918-500 1x 500 µL
CD44 Standard (HCAM/918), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details