Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8B4 Peptide - C-terminal region

OR8B4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-315, OR8B4P

UniProt

Q96RC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8B4 Rabbit Polyclonal Antibody (orb587636) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005196

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TYLTTSFPGSMNHGRFASVFYTNVVPMLNPSIYSLRNKDDKLALGKTLKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Taxilin Alpha ELISA Kit
MBS101147-01 48 Well

Rat Taxilin Alpha ELISA Kit

Sign In for Pricing
View Details
Rat Taxilin Alpha ELISA Kit
MBS101147-02 96 Well

Rat Taxilin Alpha ELISA Kit

Sign In for Pricing
View Details
Rat Taxilin Alpha ELISA Kit
MBS101147-03 5x 96 Well

Rat Taxilin Alpha ELISA Kit

Sign In for Pricing
View Details
Rat Taxilin Alpha ELISA Kit
MBS101147-04 10x 96 Well

Rat Taxilin Alpha ELISA Kit

Sign In for Pricing
View Details
Tpsg1 (NM_175593) Rat Tagged ORF Clone Lentiviral Particle
RR206611L4V 200 µL

Tpsg1 (NM_175593) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PYGM Rabbit Polyclonal Antibody
TA380592 100 µL

PYGM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details