Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8B4 Peptide - C-terminal region

OR8B4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-315, OR8B4P

UniProt

Q96RC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8B4 Rabbit Polyclonal Antibody (orb587636) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005196

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TYLTTSFPGSMNHGRFASVFYTNVVPMLNPSIYSLRNKDDKLALGKTLKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT1P3 AAV Vector (Human) (CMV)
30827101 1 µg

MT1P3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rabbit Monoclonal HLA DRB1 Antibody (HLA-DRB/7058R) [Janelia Fluor 585]
NBP3-20687JF585 0.1 mL

Rabbit Monoclonal HLA DRB1 Antibody (HLA-DRB/7058R) [Janelia Fluor 585]

Sign In for Pricing
View Details
Monkey Scl-70 Antibody ELISA Kit
MBS042947-01 48 Well

Monkey Scl-70 Antibody ELISA Kit

Sign In for Pricing
View Details
Monkey Scl-70 Antibody ELISA Kit
MBS042947-02 96 Well

Monkey Scl-70 Antibody ELISA Kit

Sign In for Pricing
View Details
Monkey Scl-70 Antibody ELISA Kit
MBS042947-03 5x 96 Well

Monkey Scl-70 Antibody ELISA Kit

Sign In for Pricing
View Details
Monkey Scl-70 Antibody ELISA Kit
MBS042947-04 10x 96 Well

Monkey Scl-70 Antibody ELISA Kit

Sign In for Pricing
View Details