Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5R1 Peptide - C-terminal region

OR5R1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-185, OR5R1P

UniProt

Q8NH85

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5R1 Rabbit Polyclonal Antibody (orb587643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004744

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STCGSHMVTVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA1D Protein Vector (Human) (pPM-C-His)
PV079056 500 ng

FRA1D Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Ubiquitin Antibody, Clone FK2
SMC-550S 12 µg

Ubiquitin Antibody, Clone FK2

Sign In for Pricing
View Details
NCC Antibody (HRP)
orb152702 100 µg

NCC Antibody (HRP)

Sign In for Pricing
View Details
CACNB4 Rabbit Polyclonal Antibody
orb156242-01 50 μL

CACNB4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CACNB4 Rabbit Polyclonal Antibody
orb156242-02 100 µL

CACNB4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CACNB4 Rabbit Polyclonal Antibody
orb156242-03 200 µL

CACNB4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details