Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5R1 Peptide - C-terminal region

OR5R1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-185, OR5R1P

UniProt

Q8NH85

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5R1 Rabbit Polyclonal Antibody (orb587643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004744

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STCGSHMVTVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CS RT NW RFID 5 Users USB 3 SMA AE Software
362960 Box of 1 Piece(s)

CS RT NW RFID 5 Users USB 3 SMA AE Software

Sign In for Pricing
View Details
Rat FETUA(Fetuin A) ELISA Kit
SYP-R0331-01 48 Well

Rat FETUA(Fetuin A) ELISA Kit

Sign In for Pricing
View Details
Rat FETUA(Fetuin A) ELISA Kit
SYP-R0331-02 96 Well

Rat FETUA(Fetuin A) ELISA Kit

Sign In for Pricing
View Details
Human FDX1 Protein
orb81114-01 5 µg

Human FDX1 Protein

Sign In for Pricing
View Details
Human FDX1 Protein
orb81114-02 25 µg

Human FDX1 Protein

Sign In for Pricing
View Details
Human FDX1 Protein
orb81114-03 1 mg

Human FDX1 Protein

Sign In for Pricing
View Details