Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8K1 Peptide - C-terminal region

OR8K1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-182, OR8N1P

UniProt

Q8NGG5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8K1 Rabbit Polyclonal Antibody (orb587653) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002907

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILRMNSRKGRYKAFSTCSSHLTVVIMFYGTLLFIYLQPKSSHTLAIDKMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTER Mouse Monoclonal Antibody [Clone ID: OTI2F9]
TA813177S 30 µL

PTER Mouse Monoclonal Antibody [Clone ID: OTI2F9]

Sign In for Pricing
View Details
Mouse Stromal cell derived factor 1beta, SDF-1beta ELISA Kit
MBS161484-01 48 Well

Mouse Stromal cell derived factor 1beta, SDF-1beta ELISA Kit

Sign In for Pricing
View Details
Mouse Stromal cell derived factor 1beta, SDF-1beta ELISA Kit
MBS161484-02 96 Well

Mouse Stromal cell derived factor 1beta, SDF-1beta ELISA Kit

Sign In for Pricing
View Details
Mouse Stromal cell derived factor 1beta, SDF-1beta ELISA Kit
MBS161484-03 5x 96 Well

Mouse Stromal cell derived factor 1beta, SDF-1beta ELISA Kit

Sign In for Pricing
View Details
Mouse Stromal cell derived factor 1beta, SDF-1beta ELISA Kit
MBS161484-04 10x 96 Well

Mouse Stromal cell derived factor 1beta, SDF-1beta ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Sppl3 shRNA (UAS) - Lentiviral mouseSppl3 shRNA (UAS, GFP) (25)
GTR15221756 1 Vial

Lentiviral mouse Sppl3 shRNA (UAS) - Lentiviral mouseSppl3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details