Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8K1 Peptide - C-terminal region

OR8K1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-182, OR8N1P

UniProt

Q8NGG5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8K1 Rabbit Polyclonal Antibody (orb587653) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002907

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILRMNSRKGRYKAFSTCSSHLTVVIMFYGTLLFIYLQPKSSHTLAIDKMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam122b Rabbit Polyclonal Antibody (HRP)
orb2108636 100 µL

Fam122b Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
GSK3β Rabbit mAb
E45R13069N-100 100 µL

GSK3β Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal MYO3A Antibody
NBP3-17742-25ul 25 µL

Rabbit Polyclonal MYO3A Antibody

Sign In for Pricing
View Details
FSBP siRNA (Human)
MBS8210965-01 15 nmol

FSBP siRNA (Human)

Sign In for Pricing
View Details
FSBP siRNA (Human)
MBS8210965-02 30 nmol

FSBP siRNA (Human)

Sign In for Pricing
View Details
FSBP siRNA (Human)
MBS8210965-03 5x 30 nmol

FSBP siRNA (Human)

Sign In for Pricing
View Details