Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6Q1 Peptide - C-terminal region

OR6Q1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-226

UniProt

Q8NGQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6Q1 Rabbit Polyclonal Antibody (orb587655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005186

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FMYVQTKVTSSINFNKVVSVFYSVVTPMLNPLIYSLRNKEVKGALGRVFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROBO1 Rabbit Polyclonal Antibody
ER1706-24 100 µL

ROBO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sell Rat Monoclonal Antibody [Clone ID: MEL-14]
CL032BX 300 µg

Sell Rat Monoclonal Antibody [Clone ID: MEL-14]

Sign In for Pricing
View Details
Automated Blood Culture System BBCS-101
BBCS-101 1 Unit

Automated Blood Culture System BBCS-101

Sign In for Pricing
View Details
1H-Imidazole-2-carboxaldehyde
TRC-I350215-25G 25 g

1H-Imidazole-2-carboxaldehyde

Sign In for Pricing
View Details
BRUNOL6 (CELF6) (NM_001172684) Human Over-expression Lysate
LC433113 20 µg

BRUNOL6 (CELF6) (NM_001172684) Human Over-expression Lysate

Sign In for Pricing
View Details
SEPTIN4 (NM_080416) Human Over-expression Lysate
LC403308 20 µg

SEPTIN4 (NM_080416) Human Over-expression Lysate

Sign In for Pricing
View Details