OR6Q1 Peptide - C-terminal region
OR6Q1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-226
UniProt
Q8NGQ2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR6Q1 Rabbit Polyclonal Antibody (orb587655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005186
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FMYVQTKVTSSINFNKVVSVFYSVVTPMLNPLIYSLRNKEVKGALGRVFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC401490 20 µg
EDG4 (LPAR2) (NM_004720) Human Over-expression Lysate
Sign In for Pricing
View Details ![GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI6A6]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908c63/imageurl/cf811963.webp)
CF811963 100 µg
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI6A6]
Sign In for Pricing
View Details 
RD-VEGFB-Ra-01 96 Tests
Rat Vascular Endothelial Growth Factor B (VEGFB) ELISA Kit
Sign In for Pricing
View Details RD-VEGFB-Ra-02 48 Tests
Rat Vascular Endothelial Growth Factor B (VEGFB) ELISA Kit
Sign In for Pricing
View Details 