Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8U9 Peptide - C-terminal region

OR8U9 Peptide - C-terminal region

Product Specifications

UniProt

P0C7N5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8U9 Rabbit Polyclonal Antibody (orb587658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013375

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEALKKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Bright™ Violet 510 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
E-AB-F0990R1 50 Tests

Elab Bright™ Violet 510 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]

Sign In for Pricing
View Details
Recombinant Columba livia Annexin A1 isoform p37 (CP37)
MBS1475897-01 0.02 mg (E-Coli)

Recombinant Columba livia Annexin A1 isoform p37 (CP37)

Sign In for Pricing
View Details
Recombinant Columba livia Annexin A1 isoform p37 (CP37)
MBS1475897-02 0.02 mg (Yeast)

Recombinant Columba livia Annexin A1 isoform p37 (CP37)

Sign In for Pricing
View Details
Recombinant Columba livia Annexin A1 isoform p37 (CP37)
MBS1475897-03 0.1 mg (E-Coli)

Recombinant Columba livia Annexin A1 isoform p37 (CP37)

Sign In for Pricing
View Details
Recombinant Columba livia Annexin A1 isoform p37 (CP37)
MBS1475897-04 0.1 mg (Yeast)

Recombinant Columba livia Annexin A1 isoform p37 (CP37)

Sign In for Pricing
View Details
Recombinant Columba livia Annexin A1 isoform p37 (CP37)
MBS1475897-05 0.02 mg (Baculovirus)

Recombinant Columba livia Annexin A1 isoform p37 (CP37)

Sign In for Pricing
View Details