Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8U9 Peptide - C-terminal region

OR8U9 Peptide - C-terminal region

Product Specifications

UniProt

P0C7N5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8U9 Rabbit Polyclonal Antibody (orb587658) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013375

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEALKKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUPT16H (Suppressor of Ty 16 Homolog (S. cerevisiae), CDC68, FACT, FACTP140, FLJ10857, FLJ14010, FLJ34357, SPT16/CDC68) (FITC)
MBS6175375-01 0.1 mL

SUPT16H (Suppressor of Ty 16 Homolog (S. cerevisiae), CDC68, FACT, FACTP140, FLJ10857, FLJ14010, FLJ34357, SPT16/CDC68) (FITC)

Sign In for Pricing
View Details
SUPT16H (Suppressor of Ty 16 Homolog (S. cerevisiae), CDC68, FACT, FACTP140, FLJ10857, FLJ14010, FLJ34357, SPT16/CDC68) (FITC)
MBS6175375-02 5x 0.1 mL

SUPT16H (Suppressor of Ty 16 Homolog (S. cerevisiae), CDC68, FACT, FACTP140, FLJ10857, FLJ14010, FLJ34357, SPT16/CDC68) (FITC)

Sign In for Pricing
View Details
DNALI1 (Axonemal Dynein Light Intermediate Polypeptide 1, Inner Dynein Arm Light Chain, Axonemal, hp28, DJ423B22.5) (MaxLight 550)
MBS6376465-01 0.1 mL

DNALI1 (Axonemal Dynein Light Intermediate Polypeptide 1, Inner Dynein Arm Light Chain, Axonemal, hp28, DJ423B22.5) (MaxLight 550)

Sign In for Pricing
View Details
DNALI1 (Axonemal Dynein Light Intermediate Polypeptide 1, Inner Dynein Arm Light Chain, Axonemal, hp28, DJ423B22.5) (MaxLight 550)
MBS6376465-02 5x 0.1 mL

DNALI1 (Axonemal Dynein Light Intermediate Polypeptide 1, Inner Dynein Arm Light Chain, Axonemal, hp28, DJ423B22.5) (MaxLight 550)

Sign In for Pricing
View Details
PTPN5 Antibody
GWB-MP981I 50 µg

PTPN5 Antibody

Sign In for Pricing
View Details
CD95/FAS Polyclonal Antibody, Cy7 Conjugated
bs-6477R-Cy7-01 20 µL

CD95/FAS Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details