OR10AD1 Peptide - C-terminal region
OR10AD1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR10AD1P, OR12-1
UniProt
Q8NGE0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR10AD1 Rabbit Polyclonal Antibody (orb587669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004134
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSKASSSGRGKTFSTCASHLTVVIFLYTSAMFSYMNPHSTHGPDKDKPFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC402784 20 µg
TEM7 (PLXDC1) (NM_020405) Human Over-expression Lysate
Sign In for Pricing
View Details ![NSE2 (NSMCE2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A2]](https://cdn.genprice.uk/products/937/6868c332994c49e6dc3f0e81/imageurl/ta501632bm.webp)
TA501632BM 100 µL
NSE2 (NSMCE2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A2]
Sign In for Pricing
View Details