OR10AD1 Peptide - C-terminal region
OR10AD1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR10AD1P, OR12-1
UniProt
Q8NGE0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR10AD1 Rabbit Polyclonal Antibody (orb587669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004134
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSKASSSGRGKTFSTCASHLTVVIFLYTSAMFSYMNPHSTHGPDKDKPFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-NOS2-Rb-01 96 Tests
Rabbit Nitric Oxide Synthase 2, Inducible (NOS2) ELISA Kit
Sign In for Pricing
View Details RDR-NOS2-Rb-02 48 Tests
Rabbit Nitric Oxide Synthase 2, Inducible (NOS2) ELISA Kit
Sign In for Pricing
View Details ![PYK2 Recombinant Rabbit Monoclonal Antibody [SC06-15]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81b2c/imageurl/et1610-82.webp)
ET1610-82 100 µL
PYK2 Recombinant Rabbit Monoclonal Antibody [SC06-15]
Sign In for Pricing
View Details ![Pellino 1 (PELI1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D9]](https://cdn.genprice.uk/products/937/68dd1b7e061270361ea1d8e8/imageurl/ta807506bm.webp)
TA807506BM 100 µL
Pellino 1 (PELI1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D9]
Sign In for Pricing
View Details 
