Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10J5 Peptide - C-terminal region

OR10J5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1-28

UniProt

Q8NHC4

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10J5 Rabbit Polyclonal Antibody (orb587678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004469

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Decarboxy Enrofloxacin
007615 5 mg

Decarboxy Enrofloxacin

Sign In for Pricing
View Details
CD69 antibody (allophycocyanin)
61R-1740 100 ug

CD69 antibody (allophycocyanin)

Sign In for Pricing
View Details
Mrps18c-set siRNA/shRNA/RNAi Lentivector (Mouse)
30546094 4x 500 ng

Mrps18c-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Antidepressant agent 1
HY-136171-01 5 mg

Antidepressant agent 1

Sign In for Pricing
View Details
Antidepressant agent 1
HY-136171-02 10 mM - 1 mL

Antidepressant agent 1

Sign In for Pricing
View Details
Antidepressant agent 1
HY-136171-03 10 mg

Antidepressant agent 1

Sign In for Pricing
View Details