Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10J5 Peptide - C-terminal region

OR10J5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1-28

UniProt

Q8NHC4

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10J5 Rabbit Polyclonal Antibody (orb587678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004469

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat UDP-glucuronosyltransferase 1-5 (Ugt1) , partial
MBS7086174 Inquire

Recombinant Rat UDP-glucuronosyltransferase 1-5 (Ugt1) , partial

Sign In for Pricing
View Details
Anti-PITRM1 Antibody Picoband®, iFluor647 Conjugate
A08969-1-iFluor647 100 µg

Anti-PITRM1 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
RPL15, NT (RPL15, EC45, 60S ribosomal protein L15) (MaxLight 650) discontinued
041194-ML650 100 µL

RPL15, NT (RPL15, EC45, 60S ribosomal protein L15) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Anti-Cytokeratin 14 Rabbit Monoclonal Antibody
MA2169-.1 100 µL

Anti-Cytokeratin 14 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Interleukin 15 (IL-15) (AP)
MBS6121812-01 0.1 mL

Interleukin 15 (IL-15) (AP)

Sign In for Pricing
View Details
Interleukin 15 (IL-15) (AP)
MBS6121812-02 5x 0.1 mL

Interleukin 15 (IL-15) (AP)

Sign In for Pricing
View Details