Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52W1 Peptide - C-terminal region

OR52W1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-71, OR52W1P

UniProt

Q6IF63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52W1 Rabbit Polyclonal Antibody (orb587694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005178

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVELVVGNTQATNLYGLALSLAISGMDILGITGSYGLIAHAVLQLPTREA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epsin 3 siRNA (m)
sc-144915 10 µM

Epsin 3 siRNA (m)

Sign In for Pricing
View Details
Rabbit Aminopeptidase ELISA Kit
MBS752357-01 48 Well

Rabbit Aminopeptidase ELISA Kit

Sign In for Pricing
View Details
Rabbit Aminopeptidase ELISA Kit
MBS752357-02 96 Well

Rabbit Aminopeptidase ELISA Kit

Sign In for Pricing
View Details
Rabbit Aminopeptidase ELISA Kit
MBS752357-03 5x 96 Well

Rabbit Aminopeptidase ELISA Kit

Sign In for Pricing
View Details
Rabbit Aminopeptidase ELISA Kit
MBS752357-04 10x 96 Well

Rabbit Aminopeptidase ELISA Kit

Sign In for Pricing
View Details
RMal d 1 (a1454)
ED7671 25 Tests

RMal d 1 (a1454)

Sign In for Pricing
View Details