Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52W1 Peptide - C-terminal region

OR52W1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-71, OR52W1P

UniProt

Q6IF63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52W1 Rabbit Polyclonal Antibody (orb587694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005178

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVELVVGNTQATNLYGLALSLAISGMDILGITGSYGLIAHAVLQLPTREA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGN1 Antibody (N-term) [APR12388G]
APR12388G-01 50 µL

HMGN1 Antibody (N-term) [APR12388G]

Sign In for Pricing
View Details
HMGN1 Antibody (N-term) [APR12388G]
APR12388G-02 100 µL

HMGN1 Antibody (N-term) [APR12388G]

Sign In for Pricing
View Details
HMGN1 Antibody (N-term) [APR12388G]
APR12388G-03 200 µL

HMGN1 Antibody (N-term) [APR12388G]

Sign In for Pricing
View Details
HMGN1 Antibody (N-term) [APR12388G]
APR12388G-04 400 µL

HMGN1 Antibody (N-term) [APR12388G]

Sign In for Pricing
View Details
MOAP1 Protein Lysate
OCOA08645-20UG 20 µg

MOAP1 Protein Lysate

Sign In for Pricing
View Details
RFKP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV773819 1.0 µg DNA

RFKP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details