Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PATE4 Peptide - middle region

PATE4 Peptide - middle region

Product Specifications

Product Name Alternative

PATE-B

UniProt

P0C8F1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PATE4 Rabbit Polyclonal Antibody (orb327074) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138346

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCCDRNFC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CINP Mouse Monoclonal Antibody [Clone ID: LBI3E1]
AMM20671VCF 100 µg

CINP Mouse Monoclonal Antibody [Clone ID: LBI3E1]

Sign In for Pricing
View Details
ldh1 Antibody, Biotin conjugated
A51154-50UG 50 µg

ldh1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit Anoctamin 4 (ANO4) ELISA kit
GTR10430933 96 Well

Rabbit Anoctamin 4 (ANO4) ELISA kit

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Type II secretion system protein N (xcpP), partial
MBS7082375 Inquire

Recombinant Pseudomonas aeruginosa Type II secretion system protein N (xcpP), partial

Sign In for Pricing
View Details
Genesig Real-Time PCR detection kit for Mycoplasma bovis, Advanced
349277 1 Kit

Genesig Real-Time PCR detection kit for Mycoplasma bovis, Advanced

Sign In for Pricing
View Details
Lentiviral mouse Epyc shRNA (UAS) - Lentiviral mouse Epyc shRNA (UAS, iRFP) (25)
GTR15299321 1 Vial

Lentiviral mouse Epyc shRNA (UAS) - Lentiviral mouse Epyc shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details