Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PATE4 Peptide - middle region

PATE4 Peptide - middle region

Product Specifications

Product Name Alternative

PATE-B

UniProt

P0C8F1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PATE4 Rabbit Polyclonal Antibody (orb327074) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138346

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCCDRNFC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thiophene-3-boronic acid
OR5445-01 5 g

Thiophene-3-boronic acid

Sign In for Pricing
View Details
Thiophene-3-boronic acid
OR5445-02 25 g

Thiophene-3-boronic acid

Sign In for Pricing
View Details
Lentiviral mouse Adad2 shRNA (UAS) - Lentiviral mouse Adad2 shRNA (UAS) plasmid
GTR15216103 1 Vial

Lentiviral mouse Adad2 shRNA (UAS) - Lentiviral mouse Adad2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Beta tubulin Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-20694R-BF350 100 µL

Beta tubulin Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
3T3 FFPE Cell Pellet Slides
AniFFPE-CP002 5 Slides

3T3 FFPE Cell Pellet Slides

Sign In for Pricing
View Details
Rabbit Polyclonal Caveolin-2 Antibody [HRP]
NBP2-99448H 0.1 mL

Rabbit Polyclonal Caveolin-2 Antibody [HRP]

Sign In for Pricing
View Details