PGAM4 Peptide - C-terminal region
PGAM4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PGAM-B, PGAM1, PGAM3, dJ1000K24.1
UniProt
Q8N0Y7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PGAM4 Rabbit Polyclonal Antibody (orb587703) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001025062
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KDRRYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKRVLIAAHG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472906-100 1x 100 µL
CD72 (B Cell Marker) (BU40), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY400588 100 µg
ENT2 (SLC29A2) (NM_001532) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC470731-100 1x 100 µL
AMACR / p504S (Rabbit PAb), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY429085 100 µg
Decorin (DCN) (NM_001920) Human Over-expression Lysate
Sign In for Pricing
View Details