PGAM4 Peptide - C-terminal region
PGAM4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PGAM-B, PGAM1, PGAM3, dJ1000K24.1
UniProt
Q8N0Y7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PGAM4 Rabbit Polyclonal Antibody (orb587703) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001025062
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KDRRYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKRVLIAAHG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![LMAN1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]](https://cdn.genprice.uk/products/937/6868c333994c49e6dc3f16cb/imageurl/ta502237bm.webp)
TA502237BM 100 µL
LMAN1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]
Sign In for Pricing
View Details ![1-Boc-2-[4-(2-pyridinyl)benzylidene]hydrazine](https://cdn.genprice.uk/products/572/1482171664208/imageurl/trc-b665200-5g.webp)
![NCAM1 Recombinant Rabbit Monoclonal Antibody [PSH06-82]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82a2e/imageurl/ha722755.webp)
HA722755 100 µL
NCAM1 Recombinant Rabbit Monoclonal Antibody [PSH06-82]
Sign In for Pricing
View Details ![RARRES1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D2]](https://cdn.genprice.uk/products/937/68dd1b71061270361ea188c1/imageurl/ta506089am.webp)
TA506089AM 100 µL
RARRES1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D2]
Sign In for Pricing
View Details 