Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGPEP1L Peptide - N-terminal region

PGPEP1L Peptide - N-terminal region

Product Specifications

UniProt

A6NFU8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGPEP1L Rabbit Polyclonal Antibody (orb327077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001096082

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GMDTAAKAIILEQSGKNQGYRDADIRSFWPEGGVCLPGSPDVLESGVCMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Omeprazole Sulfone N-Oxide
TRC-O635030-25MG 25 mg

Omeprazole Sulfone N-Oxide

Sign In for Pricing
View Details
IL8/CXCL8 Antibody
KC-405-01 50 μL

IL8/CXCL8 Antibody

Sign In for Pricing
View Details
IL8/CXCL8 Antibody
KC-405-02 100 µL

IL8/CXCL8 Antibody

Sign In for Pricing
View Details
IL8/CXCL8 Antibody
KC-405-03 1 mL

IL8/CXCL8 Antibody

Sign In for Pricing
View Details
PSMA3 (NM_002788) Human Over-expression Lysate
LY419116 100 µg

PSMA3 (NM_002788) Human Over-expression Lysate

Sign In for Pricing
View Details
GM648 Rabbit Polyclonal Antibody
ER1902-26 100 µL

GM648 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details