Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGPEP1L Peptide - N-terminal region

PGPEP1L Peptide - N-terminal region

Product Specifications

UniProt

A6NFU8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGPEP1L Rabbit Polyclonal Antibody (orb327077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001096082

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GMDTAAKAIILEQSGKNQGYRDADIRSFWPEGGVCLPGSPDVLESGVCMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tin2 (TINF2) activation kit by CRISPRa
GA108839 1 Kit

Human Tin2 (TINF2) activation kit by CRISPRa

Sign In for Pricing
View Details
FABP1 Polyclonal Antibody
AN006980L-01 25 µL

FABP1 Polyclonal Antibody

Sign In for Pricing
View Details
FABP1 Polyclonal Antibody
AN006980L-02 100 µL

FABP1 Polyclonal Antibody

Sign In for Pricing
View Details
Human LMAN1L activation kit by CRISPRa
GA112599 1 Kit

Human LMAN1L activation kit by CRISPRa

Sign In for Pricing
View Details
L-Cysteinyl-L-cysteine TFA Salt (Technical Grade)
TRC-C999990-10MG 10 mg

L-Cysteinyl-L-cysteine TFA Salt (Technical Grade)

Sign In for Pricing
View Details
ECHS1 Polyclonal Antibody
E-AB-11174-01 20 µL

ECHS1 Polyclonal Antibody

Sign In for Pricing
View Details