Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGLB2 Peptide - middle region

PLGLB2 Peptide - middle region

Product Specifications

UniProt

Q02325

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLGLB2 Rabbit Polyclonal Antibody (orb587707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002656

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGC:31936 Protein Vector (Human) (pPB-N-His)
PV025886 500 ng

MGC:31936 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Protein Disulfide Isomerase A5 (PDIA5)
MBS2029898-01 0.01 mg

Recombinant Protein Disulfide Isomerase A5 (PDIA5)

Sign In for Pricing
View Details
Recombinant Protein Disulfide Isomerase A5 (PDIA5)
MBS2029898-02 0.05 mg

Recombinant Protein Disulfide Isomerase A5 (PDIA5)

Sign In for Pricing
View Details
Recombinant Protein Disulfide Isomerase A5 (PDIA5)
MBS2029898-03 0.1 mg

Recombinant Protein Disulfide Isomerase A5 (PDIA5)

Sign In for Pricing
View Details
Recombinant Protein Disulfide Isomerase A5 (PDIA5)
MBS2029898-04 0.2 mg

Recombinant Protein Disulfide Isomerase A5 (PDIA5)

Sign In for Pricing
View Details
Recombinant Protein Disulfide Isomerase A5 (PDIA5)
MBS2029898-05 0.5 mg

Recombinant Protein Disulfide Isomerase A5 (PDIA5)

Sign In for Pricing
View Details