Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PM20D1 Peptide - N-terminal region

PM20D1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Cps1

UniProt

Q6GTS8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PM20D1 Rabbit Polyclonal Antibody (orb587709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689704

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5ME Protein Lysate
OCOA11794-20UG 20 µg

ATP5ME Protein Lysate

Sign In for Pricing
View Details
CORO7 Human siRNA Oligo Duplex (Locus ID 79585)
SR312443 1 Kit

CORO7 Human siRNA Oligo Duplex (Locus ID 79585)

Sign In for Pricing
View Details
1-Propyl-1,4-diazepane
OR1021046 1 Each

1-Propyl-1,4-diazepane

Sign In for Pricing
View Details
DL-Carnitine HCl
C16751-10mM/1mL 10 mM/1mL

DL-Carnitine HCl

Sign In for Pricing
View Details
CD68 (GP110, LAMP4, Microsialin, Macrosialin, SCARD1, Scavenger Receptor Class D Member-1) (HRP)
168715-AF-HRP 100 µL

CD68 (GP110, LAMP4, Microsialin, Macrosialin, SCARD1, Scavenger Receptor Class D Member-1) (HRP)

Sign In for Pricing
View Details
MBD3L1 Double Nickase Plasmid (m2)
sc-428585-NIC-2 20 µg

MBD3L1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details