Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PM20D1 Peptide - N-terminal region

PM20D1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Cps1

UniProt

Q6GTS8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PM20D1 Rabbit Polyclonal Antibody (orb587709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689704

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Peroxiredoxin-1 (PRDX1)
CSB-RP011654h-01 10 µg

Human Peroxiredoxin-1 (PRDX1)

Sign In for Pricing
View Details
Human Peroxiredoxin-1 (PRDX1)
CSB-RP011654h-02 50 µg

Human Peroxiredoxin-1 (PRDX1)

Sign In for Pricing
View Details
Human Peroxiredoxin-1 (PRDX1)
CSB-RP011654h-03 100 µg

Human Peroxiredoxin-1 (PRDX1)

Sign In for Pricing
View Details
Human Peroxiredoxin-1 (PRDX1)
CSB-RP011654h-04 200 µg

Human Peroxiredoxin-1 (PRDX1)

Sign In for Pricing
View Details
Human Peroxiredoxin-1 (PRDX1)
CSB-RP011654h-05 500 µg

Human Peroxiredoxin-1 (PRDX1)

Sign In for Pricing
View Details
Human Peroxiredoxin-1 (PRDX1)
CSB-RP011654h-06 1 mg

Human Peroxiredoxin-1 (PRDX1)

Sign In for Pricing
View Details