Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS36 Peptide - N-terminal region

PRSS36 Peptide - N-terminal region

Product Specifications

UniProt

Q5K4E3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS36 Rabbit Polyclonal Antibody (orb587720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775773

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLLLPLVMLVISPIPGAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHAF2 (NM_017841) Human Over-expression Lysate
LY402625 100 µg

SDHAF2 (NM_017841) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Conjugated Anti-Mouse CD4 Recombinant Antibody [PSH04-99] - Rabbit IgG (Chimeric)
HA720204F 100 µL

APC Conjugated Anti-Mouse CD4 Recombinant Antibody [PSH04-99] - Rabbit IgG (Chimeric)

Sign In for Pricing
View Details
Asimilobine Hydrochloride
TRC-A727450-2.5MG 2.5 mg

Asimilobine Hydrochloride

Sign In for Pricing
View Details
ALDH1A1 Human Gene Knockout Kit (CRISPR)
KN200723 1 Kit

ALDH1A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cadherin 22 (CDH22) Human Gene Knockout Kit (CRISPR)
KN419512 1 Kit

Cadherin 22 (CDH22) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
9-(4’-Nitrophenyl)-9H-pyrido[3,4-b]indole
TRC-N504500-25MG 25 mg

9-(4’-Nitrophenyl)-9H-pyrido[3,4-b]indole

Sign In for Pricing
View Details