PRSS36 Peptide - N-terminal region
PRSS36 Peptide - N-terminal region
Product Specifications
UniProt
Q5K4E3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRSS36 Rabbit Polyclonal Antibody (orb587720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775773
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HLLLPLVMLVISPIPGAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA-2359-2 2 mL
Texas Red Conjugated Rabbit Polyclonal Antibody to Swine IgG
Sign In for Pricing
View Details 
MT02F4-AM1 10x 96 Well Plates
Amine Treated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS
Sign In for Pricing
View Details