Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REXO1L1P Peptide - middle region

REXO1L1P Peptide - middle region

Product Specifications

Product Name Alternative

GOR, REXO1L1

UniProt

Q8IX06

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REXO1L1P Rabbit Polyclonal Antibody (orb327098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758439

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASSSQRSRGSKVGRQPGKTRNRSGMACKTTATTSSKRIVRRASLPSLSLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 3, IL-3 ELISA KIT
YLA1520HU-01 48 Tests

Human Interleukin 3, IL-3 ELISA KIT

Sign In for Pricing
View Details
Human Interleukin 3, IL-3 ELISA KIT
YLA1520HU-02 96 Tests

Human Interleukin 3, IL-3 ELISA KIT

Sign In for Pricing
View Details
CGGBP1 Human Over-expression Lysate
orb1342477 100 µg

CGGBP1 Human Over-expression Lysate

Sign In for Pricing
View Details
(+/-) -Marmesin
BUP22923-01 1 mg

(+/-) -Marmesin

Sign In for Pricing
View Details
(+/-) -Marmesin
BUP22923-02 5 mg

(+/-) -Marmesin

Sign In for Pricing
View Details
(+/-) -Marmesin
BUP22923-03 10 mg

(+/-) -Marmesin

Sign In for Pricing
View Details