Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THUMPD3 Peptide - N-terminal region

THUMPD3 Peptide - N-terminal region

Product Specifications

UniProt

Q9BV44

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THUMPD3 Rabbit Polyclonal Antibody (orb587772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005265081

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGKLPWSNPLKVWKINASFKKKKAKRKKINQNSSKEKINNGQEVKIDQRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMPDH1 (NM_000883) Human Recombinant Protein
TP315206 20 µg

IMPDH1 (NM_000883) Human Recombinant Protein

Sign In for Pricing
View Details
FBXO2 Antibody - C-terminal region
OAAB00217-400UL 400 µL

FBXO2 Antibody - C-terminal region

Sign In for Pricing
View Details
3,4-Difluorophenylzinc bromide 0.5M solution in THF
PC8498 1 Each

3,4-Difluorophenylzinc bromide 0.5M solution in THF

Sign In for Pricing
View Details
Kit ligand
MBS7042993-01 0.02 mg

Kit ligand

Sign In for Pricing
View Details
Kit ligand
MBS7042993-02 0.1 mg

Kit ligand

Sign In for Pricing
View Details
Kit ligand
MBS7042993-03 5x 0.1 mg

Kit ligand

Sign In for Pricing
View Details