Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THUMPD3 Peptide - N-terminal region

THUMPD3 Peptide - N-terminal region

Product Specifications

UniProt

Q9BV44

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THUMPD3 Rabbit Polyclonal Antibody (orb587772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005265081

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGKLPWSNPLKVWKINASFKKKKAKRKKINQNSSKEKINNGQEVKIDQRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM24A Protein Vector (Human) (pPM-C-HA)
PV077259 500 ng

FAM24A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR160W (YGR160W) , partial
MBS7061480 Inquire

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGR160W (YGR160W) , partial

Sign In for Pricing
View Details
Mouse Defensin Alpha 6, Paneth Cell Specific (DEFa6) ELISA Kit
orb2809807-01 48 Tests

Mouse Defensin Alpha 6, Paneth Cell Specific (DEFa6) ELISA Kit

Sign In for Pricing
View Details
Mouse Defensin Alpha 6, Paneth Cell Specific (DEFa6) ELISA Kit
orb2809807-02 96 Tests

Mouse Defensin Alpha 6, Paneth Cell Specific (DEFa6) ELISA Kit

Sign In for Pricing
View Details
Mouse Defensin Alpha 6, Paneth Cell Specific (DEFa6) ELISA Kit
orb2809807-03 5 x 96 T

Mouse Defensin Alpha 6, Paneth Cell Specific (DEFa6) ELISA Kit

Sign In for Pricing
View Details
Custom Polyclonal Antibodies, Western Blot
CS010-031 Per Test

Custom Polyclonal Antibodies, Western Blot

Sign In for Pricing
View Details