Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E2B Peptide - N-terminal region

SLC35E2B Peptide - N-terminal region

Product Specifications

Product Name Alternative

SLC35E2

UniProt

P0CK96

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35E2B Rabbit Polyclonal Antibody (orb587816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001104251

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpn1 (NM_013067) Rat Tagged ORF Clone Lentiviral Particle
RR215237L3V 200 µL

Rpn1 (NM_013067) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Bovine Soluble Lectin-like oxidized low density lipoprotein receptor-1 ELISA Kit
MBS754635-01 48 Well

Bovine Soluble Lectin-like oxidized low density lipoprotein receptor-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Soluble Lectin-like oxidized low density lipoprotein receptor-1 ELISA Kit
MBS754635-02 96 Well

Bovine Soluble Lectin-like oxidized low density lipoprotein receptor-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Soluble Lectin-like oxidized low density lipoprotein receptor-1 ELISA Kit
MBS754635-03 5x 96 Well

Bovine Soluble Lectin-like oxidized low density lipoprotein receptor-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Soluble Lectin-like oxidized low density lipoprotein receptor-1 ELISA Kit
MBS754635-04 10x 96 Well

Bovine Soluble Lectin-like oxidized low density lipoprotein receptor-1 ELISA Kit

Sign In for Pricing
View Details
1-Ethyl-2-methylpyridinium bromide
IL-0225-HP-BULK 1 Each

1-Ethyl-2-methylpyridinium bromide

Sign In for Pricing
View Details