Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E2B Peptide - N-terminal region

SLC35E2B Peptide - N-terminal region

Product Specifications

Product Name Alternative

SLC35E2

UniProt

P0CK96

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35E2B Rabbit Polyclonal Antibody (orb587816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001104251

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal 14-3-3 gamma Antibody (AT4B9) [PerCP]
NBP2-50579PCP 0.1 mL

Mouse Monoclonal 14-3-3 gamma Antibody (AT4B9) [PerCP]

Sign In for Pricing
View Details
HER3, Rhesus Macaque (HEK293, Fc)
HY-P76968-01 20 µg

HER3, Rhesus Macaque (HEK293, Fc)

Sign In for Pricing
View Details
HER3, Rhesus Macaque (HEK293, Fc)
HY-P76968-02 50 µg

HER3, Rhesus Macaque (HEK293, Fc)

Sign In for Pricing
View Details
Stac2 (NM_146028) Mouse Tagged ORF Clone Lentiviral Particle
MR206412L4V 200 µL

Stac2 (NM_146028) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
pUNO1-hTNFRSF12A
puno1-htnfrsf12a 20 µg

pUNO1-hTNFRSF12A

Sign In for Pricing
View Details
Olanexidine Hydrochloride semihydrate
S5924-5mg 5 mg

Olanexidine Hydrochloride semihydrate

Sign In for Pricing
View Details