Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCR Peptide - N-terminal region

BCR Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALL, CML, PHL, BCR1, D22S11, D22S662

UniProt

P11274

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCR Rabbit Polyclonal Antibody (orb327188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004318.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PRRX1 Antibody (OTI1E10) [PE]
NBP2-73678PE 0.1 mL

Mouse Monoclonal PRRX1 Antibody (OTI1E10) [PE]

Sign In for Pricing
View Details
Vmn2r110 CRISPR Activation Plasmid (m2)
sc-432458-ACT-2 20 µg

Vmn2r110 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopH (yopH), partial
MBS7070019 Inquire

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopH (yopH), partial

Sign In for Pricing
View Details
Gpt (NM_182805) Mouse Tagged Lenti ORF Clone
MR207958L3 10 µg

Gpt (NM_182805) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Arsenazo I Trisodium (Neothorone) extrapure AR
17299 1 Gms

Arsenazo I Trisodium (Neothorone) extrapure AR

Sign In for Pricing
View Details
Anti-Hydra vulgaris Transcription Factor Sp5-like Monoclonal Antibody (1A131)
ZP005025-01 50 µg

Anti-Hydra vulgaris Transcription Factor Sp5-like Monoclonal Antibody (1A131)

Sign In for Pricing
View Details