Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCR Peptide - N-terminal region

BCR Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALL, CML, PHL, BCR1, D22S11, D22S662

UniProt

P11274

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCR Rabbit Polyclonal Antibody (orb327188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004318.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Classical Swine Fever Virus Antibodies Lateral Flow Assay Kit
E-AD-C008 40 Tests

Classical Swine Fever Virus Antibodies Lateral Flow Assay Kit

Sign In for Pricing
View Details
NFYB Protein Vector (Human) (pPM-C-HA)
PV028239 500 ng

NFYB Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
AGFG1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV703966 1.0 µg DNA

AGFG1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Arachidonyl alcohol
HY-135801-01 10 mg

Arachidonyl alcohol

Sign In for Pricing
View Details
Arachidonyl alcohol
HY-135801-02 10 mM - 1 mL

Arachidonyl alcohol

Sign In for Pricing
View Details
Arachidonyl alcohol
HY-135801-03 50 mg

Arachidonyl alcohol

Sign In for Pricing
View Details