Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAF1 Peptide - middle region

RAF1 Peptide - middle region

Product Specifications

UniProt

B4E0X2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAF1 Rabbit Polyclonal Antibody (orb587894) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005265415

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-catenin (Ab-641) antibody
MBS857401-01 0.05 mg

Alpha-catenin (Ab-641) antibody

Sign In for Pricing
View Details
Alpha-catenin (Ab-641) antibody
MBS857401-02 0.1 mg

Alpha-catenin (Ab-641) antibody

Sign In for Pricing
View Details
Alpha-catenin (Ab-641) antibody
MBS857401-03 0.1 mL (AF750)

Alpha-catenin (Ab-641) antibody

Sign In for Pricing
View Details
Alpha-catenin (Ab-641) antibody
MBS857401-04 0.1 mL (AF405M)

Alpha-catenin (Ab-641) antibody

Sign In for Pricing
View Details
Alpha-catenin (Ab-641) antibody
MBS857401-05 0.1 mL (AF546)

Alpha-catenin (Ab-641) antibody

Sign In for Pricing
View Details
Alpha-catenin (Ab-641) antibody
MBS857401-06 0.1 mL (AF405L)

Alpha-catenin (Ab-641) antibody

Sign In for Pricing
View Details