SEC13 Peptide - middle region
SEC13 Peptide - middle region
Product Specifications
UniProt
B4DXJ1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEC13 Rabbit Polyclonal Antibody (orb587911) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001129498
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PA1943-1-Cy3 100 µg/Vial
Anti-CD11b/ITGAM Antibody Picoband®, Cy3 Conjugate
Sign In for Pricing
View Details 
A06299-2-Fluoro550 100 µg/Vial
Anti-CYP2W1 Antibody Picoband® Fluoro550 Conjugated
Sign In for Pricing
View Details