SEMA3B Peptide - middle region
SEMA3B Peptide - middle region
Product Specifications
Product Name Alternative
LUCA-1, SEMA5, SEMAA, SemA, semaV
UniProt
Q13214
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEMA3B Rabbit Polyclonal Antibody (orb327191) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005914
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY403957 100 µg
PKC beta 1 (PRKCB) (NM_212535) Human Over-expression Lysate
Sign In for Pricing
View Details 
![M-CSF (CSF1) Mouse Monoclonal Antibody [Clone ID: 2D10]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbdb3/imageurl/am06393su-n.webp)
AM06393SU-N 100 µL
M-CSF (CSF1) Mouse Monoclonal Antibody [Clone ID: 2D10]
Sign In for Pricing
View Details 
BNC681468-500 1x 500 µL
MCM7 (Proliferation Marker) (MCM7/1468), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
