Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXN Peptide - C-terminal region

TXN Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRDX, TRX, TRX1

UniProt

P10599

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TXN Rabbit Polyclonal Antibody (orb333742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003320

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Placental Alkaline Phosphatase polyclonal antibody
BZ16867-01 50 µL

Placental Alkaline Phosphatase polyclonal antibody

Sign In for Pricing
View Details
Placental Alkaline Phosphatase polyclonal antibody
BZ16867-02 100 µL

Placental Alkaline Phosphatase polyclonal antibody

Sign In for Pricing
View Details
Rabbit Anti-ICAM1 antibody
SL0608R-01 50 µL

Rabbit Anti-ICAM1 antibody

Sign In for Pricing
View Details
Rabbit Anti-ICAM1 antibody
SL0608R-02 100 µL

Rabbit Anti-ICAM1 antibody

Sign In for Pricing
View Details
Rabbit Anti-ICAM1 antibody
SL0608R-03 200 µL

Rabbit Anti-ICAM1 antibody

Sign In for Pricing
View Details
Anti-NRG1 Antibody Picoband® Fluoro488 Conjugated
PA1969-Fluoro488 100 µg/Vial

Anti-NRG1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details