Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXN Peptide - C-terminal region

TXN Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRDX, TRX, TRX1

UniProt

P10599

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TXN Rabbit Polyclonal Antibody (orb333742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003320

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAV5 capsid protein VP1 Polyclonal Antibody, Cy3 Conjugated
bs-10180R-Cy3 100 µL

AAV5 capsid protein VP1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Cetirizine 100mg
A15041-100 100 mg

Cetirizine 100mg

Sign In for Pricing
View Details
Mst2 Rabbit Polyclonal Antibody (BF680)
orb2416008 100 µL

Mst2 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Mkx 3'UTR Lenti-reporter-Luc Vector
30183086 1.0 µg

Mkx 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CBL (NM_005188) Human Mutant ORF Clone
RC400479 10 µg

CBL (NM_005188) Human Mutant ORF Clone

Sign In for Pricing
View Details
MIRacle™ hsa-miR-4310 miRNA Agomir/Antagomir
AM2286 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-4310 miRNA Agomir/Antagomir

Sign In for Pricing
View Details