Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUF2 Peptide - N-terminal region

NUF2 Peptide - N-terminal region

Product Specifications

UniProt

E9PQC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUF2 Rabbit Polyclonal Antibody (orb331410) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-2,2-Difluorocyclopropanecarbaldehyde
TRC-D686960-100MG 100 mg

(S)-2,2-Difluorocyclopropanecarbaldehyde

Sign In for Pricing
View Details
CCDC16 (ZNF830) Human Gene Knockout Kit (CRISPR)
KN418305 1 Kit

CCDC16 (ZNF830) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIM61 (NM_001012414) Human Recombinant Protein
TP761647 50 µg

TRIM61 (NM_001012414) Human Recombinant Protein

Sign In for Pricing
View Details
SLC38A3 (Center) Rabbit Polyclonal Antibody
AP17749PU-N 400 µL

SLC38A3 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Allyl-2-phenyl-4-pentenenitrile
TRC-A549215-5G 5 g

2-Allyl-2-phenyl-4-pentenenitrile

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS712828 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details