Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUF2 Peptide - N-terminal region

NUF2 Peptide - N-terminal region

Product Specifications

UniProt

E9PQC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUF2 Rabbit Polyclonal Antibody (orb331410) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PABPC1L (NM_001124756) Human Over-expression Lysate
LY426626 100 µg

PABPC1L (NM_001124756) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS800724 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
Human Grancalcin/GCA, N-Twin Strep, C-His, Flag Tag
HA210563-01 20 µg

Human Grancalcin/GCA, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human Grancalcin/GCA, N-Twin Strep, C-His, Flag Tag
HA210563-02 50 µg

Human Grancalcin/GCA, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human Grancalcin/GCA, N-Twin Strep, C-His, Flag Tag
HA210563-03 100 µg

Human Grancalcin/GCA, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
UBC6e (UBE2J1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C7]
TA505029BM 100 µL

UBC6e (UBE2J1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C7]

Sign In for Pricing
View Details